CTP Synthase antibody (C-Term)

Catalog No. ABIN629790

Product Details anti-CTP Synthase Antibody

Target: CTP Synthase (CTPS)

Binding Specificity: C-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CTP Synthase antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: Ctp Synthase antibody was raised against the C terminal of CTPS

Purification: Purified

Immunogen: Ctp Synthase antibody was raised using the C terminal of CTPS corresponding to a region with amino acids FGLLLASVGRLSHYLQKGCRLSPRDTYSDRSGSSSPDSEITELKFPSINH

Application Details

Application Notes: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Ctp Synthase Blocking Peptide, catalog no. 33R-2906, is also available for use as a blocking control in assays to test for specificity of this Ctp Synthase antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CTPS antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CTP Synthase

Target: CTP Synthase (CTPS)

Alternative Name: Ctp Synthase (CTPS Products)

Background: The catalytic conversion of UTP to CTP is accomplished by the enzyme cytidine-5-prime-triphosphate synthetase. The enzyme is important in the biosynthesis of phospholipids and nucleic acids, and plays a key role in cell growth, development, and tumorigenesis.

Molecular Weight: 67 kDa (MW of target protein)

Pathways: Proton Transport, Ribonucleoside Biosynthetic Process