GIPC2 antibody (N-Term)

Catalog No. ABIN629789

Product Details anti-GIPC2 Antibody

Target: GIPC2 (GIPC PDZ Domain Containing Family, Member 2 (GIPC2))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GIPC2 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: GIPC2 antibody was raised against the N terminal of GIPC2

Purification: Purified

Immunogen: GIPC2 antibody was raised using the N terminal of GIPC2 corresponding to a region with amino acids MPLKLRGKKKAKSKETAGLVEGEPTGAGGGSLSASRAPARRLVFHAQLAH

Application Details

Application Notes: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GIPC2 Blocking Peptide, catalog no. 33R-6291, is also available for use as a blocking control in assays to test for specificity of this GIPC2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GIPC2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for GIPC2

Target: GIPC2 (GIPC PDZ Domain Containing Family, Member 2 (GIPC2))

Alternative Name: GIPC2 (GIPC2 Products)

Background: GIPC1/GIPC, GIPC2, and GIPC3 are a family of central PDZ-domain proteins. GIPC2 might play important roles in human gastric cancer through modulation of growth factor signaling or cell adhesion. GIPC1, GIPC2 and GIPC3 might play key roles in carcinogenesis and embryogenesis through modulation of growth factor signaling and cell adhesion.

Molecular Weight: 35 kDa (MW of target protein)