CES1 antibody
-
- Target See all CES1 Antibodies
- CES1 (Carboxylesterase 1 (CES1))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This CES1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Purified
- Immunogen
- Carboxylesterase 1 antibody was raised using a synthetic peptide corresponding to a region with amino acids VLGKFVSLEGFAQPVAIFLGIPFAKPPLGPLRFTPPQPAEPWSFVKNATS
- Top Product
- Discover our top product CES1 Primary Antibody
-
-
- Application Notes
-
WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
Carboxylesterase 1 Blocking Peptide, catalog no. 33R-9660, is also available for use as a blocking control in assays to test for specificity of this Carboxylesterase 1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CES1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CES1 (Carboxylesterase 1 (CES1))
- Alternative Name
- Carboxylesterase 1 (CES1 Products)
- Synonyms
- ACAT antibody, CE-1 antibody, CEH antibody, CES2 antibody, HMSE antibody, HMSE1 antibody, PCE-1 antibody, REH antibody, SES1 antibody, TGH antibody, hCE-1 antibody, CESDD1 antibody, CES1 antibody, CES-K1 antibody, APLE antibody, PMPMEase antibody, CES antibody, carboxylesterase 1 antibody, liver carboxylesterase 1 antibody, liver carboxylesterase antibody, carboxylesterase 1 (monocyte/macrophage serine esterase 1) antibody, CES1 antibody, CpipJ_CPIJ013026 antibody, CpipJ_CPIJ016339 antibody, LOC100009551 antibody, LOC454097 antibody, LOC699486 antibody, LOC100050915 antibody
- Background
- CES1 is one of the enzymes responsible for the hydrolysis of ester- and amide-bond-containing drugs such as cocaine and heroin. They also hydrolize long-chain fatty acid esters and thioesters. This enzyme is known to hydrolyze aromatic and aliphatic esters and is necessary for cellular cholesterol esterification.
- Molecular Weight
- 61 kDa (MW of target protein)
- Pathways
- Monocarboxylic Acid Catabolic Process
-