MKRN1 antibody (N-Term)
-
- Target See all MKRN1 Antibodies
- MKRN1 (Makorin Ring Finger Protein 1 (MKRN1))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse, Dog, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This MKRN1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- MKRN1 antibody was raised against the N terminal of MKRN1
- Purification
- Purified
- Immunogen
- MKRN1 antibody was raised using the N terminal of MKRN1 corresponding to a region with amino acids GDRCRYEHSKPLKQEEATATELTTKSSLAASSSLSSIVGPLVEMNTGEAE
- Top Product
- Discover our top product MKRN1 Primary Antibody
-
-
- Application Notes
-
WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
MKRN1 Blocking Peptide, catalog no. 33R-3207, is also available for use as a blocking control in assays to test for specificity of this MKRN1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MKRN1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MKRN1 (Makorin Ring Finger Protein 1 (MKRN1))
- Alternative Name
- MKRN1 (MKRN1 Products)
- Synonyms
- MKRN1 antibody, MGC84269 antibody, mkrn1 antibody, Makorin-1 antibody, RNF61 antibody, RFP antibody, makorin ring finger protein 1 antibody, E3 ubiquitin-protein ligase makorin-1 antibody, makorin ring finger protein 1 S homeolog antibody, makorin, ring finger protein, 1 antibody, MKRN1 antibody, LOC100393879 antibody, mkrn1.S antibody, Mkrn1 antibody
- Background
- The Makorin ring finger protein-1 gene (MKRN1) is a highly transcribed, intron-containing source for a family of intronless mammalian genes encoding a novel class of zinc finger proteins. Phylogenetic analyses indicate that the MKRN1 gene is the ancestral founder of this gene family.
- Molecular Weight
- 16 kDa (MW of target protein)
- Pathways
- Chromatin Binding
-