TIGD3 antibody (N-Term)

Catalog No. ABIN629782

Product Details anti-TIGD3 Antibody

Target: TIGD3 (Tigger Transposable Element Derived 3 (TIGD3))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TIGD3 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: TIGD3 antibody was raised against the N terminal of TIGD3

Purification: Purified

Immunogen: TIGD3 antibody was raised using the N terminal of TIGD3 corresponding to a region with amino acids NKEKLLADWCSGTANRERKRKRESKYSGIDEALLCWYHIARAKAWDVTGP

Application Details

Application Notes: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TIGD3 Blocking Peptide, catalog no. 33R-6738, is also available for use as a blocking control in assays to test for specificity of this TIGD3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TIGD3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TIGD3

Target: TIGD3 (Tigger Transposable Element Derived 3 (TIGD3))

Alternative Name: TIGD3 (TIGD3 Products)

Synonyms: tigger transposable element derived 3 antibody, TIGD3 antibody, Tigd3 antibody

Background: TIGD3 belongs to the tigger subfamily of the pogo superfamily of DNA-mediated transposons in humans. These proteins are related to DNA transposons found in fungi and nematodes, and more distantly to the Tc1 and mariner transposases. They are also very similar to the major mammalian centromere protein B. The exact function of TIGD3 gene is not known.

Molecular Weight: 52 kDa (MW of target protein)