TKTL2 antibody (C-Term)

Catalog No. ABIN629780

Product Details anti-TKTL2 Antibody

Target: TKTL2 (Transketolase-Like 2 (TKTL2))

Binding Specificity: C-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TKTL2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: TKTL2 antibody was raised against the C terminal of TKTL2

Purification: Purified

Immunogen: TKTL2 antibody was raised using the C terminal of TKTL2 corresponding to a region with amino acids SSAKATGGRVITVEDHYREGGIGEAVCAAVSREPDILVHQLAVSGVPQRG

Application Details

Application Notes: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TKTL2 Blocking Peptide, catalog no. 33R-8786, is also available for use as a blocking control in assays to test for specificity of this TKTL2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TKTL2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TKTL2

Target: TKTL2 (Transketolase-Like 2 (TKTL2))

Alternative Name: TKTL2 (TKTL2 Products)

Synonyms: TKTL2 antibody, 4933401I19Rik antibody, RGD1304767 antibody, transketolase like 2 antibody, transketolase-like 2 L homeolog antibody, transketolase-like 2 antibody, TKTL2 antibody, tktl2.L antibody, Tktl2 antibody

Background: TKTL2 plays an essential role in total transketolase activity and cell proliferation in cancer cells. After transfection with anti-TKTL1 siRNA, total transketolase activity dramatically decreases and proliferation was significantly inhibited in cancer cells. TKTL2 may also play a pivotal role in carcinogenesis

Molecular Weight: 68 kDa (MW of target protein)