NAA50 antibody (C-Term)
-
- Target See all NAA50 Antibodies
- NAA50 (N(alpha)-Acetyltransferase 50, NatE Catalytic Subunit (NAA50))
-
Binding Specificity
- C-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This NAA50 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- NAT13 antibody was raised against the C terminal of NAT13
- Purification
- Purified
- Immunogen
- NAT13 antibody was raised using the C terminal of NAT13 corresponding to a region with amino acids AIDFYRKFGFEIIETKKNYYKRIEPADAHVLQKNLKVPSGQNADVQKTDN
- Top Product
- Discover our top product NAA50 Primary Antibody
-
-
- Application Notes
-
WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
NAT13 Blocking Peptide, catalog no. 33R-1262, is also available for use as a blocking control in assays to test for specificity of this NAT13 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NAT13 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- NAA50 (N(alpha)-Acetyltransferase 50, NatE Catalytic Subunit (NAA50))
- Alternative Name
- NAT13 (NAA50 Products)
- Synonyms
- MAK3 antibody, NAT13 antibody, NAT5 antibody, SAN antibody, hNAT5 antibody, hSAN antibody, 2600005K24Rik antibody, 2810441M03Rik antibody, AW112078 antibody, Mak3 antibody, Mak3p antibody, Nat13 antibody, Nat5 antibody, San antibody, DKFZp469M1032 antibody, san antibody, mak3 antibody, nat5 antibody, nat13 antibody, MGC80671 antibody, N(alpha)-acetyltransferase 50, NatE catalytic subunit antibody, N(alpha)-acetyltransferase 50, NatE catalytic subunit L homeolog antibody, NAA50 antibody, Naa50 antibody, naa50.L antibody
- Background
- NAT13 is a probable catalytic component of the ARD1A-NARG1 complex which displays alpha (N-terminal) acetyltransferase activity.
- Molecular Weight
- 19 kDa (MW of target protein)
-