TRMT2B antibody (Middle Region)
-
- Target See all TRMT2B Antibodies
- TRMT2B (tRNA Methyltransferase 2 Homolog B (TRMT2B))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This TRMT2B antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- CXORF34 antibody was raised against the middle region of Cxorf34
- Purification
- Purified
- Immunogen
- CXORF34 antibody was raised using the middle region of Cxorf34 corresponding to a region with amino acids GAACGLTSLYFQESTMTRCSHQQSPYQLLFGEPYIFEELLSLKIRISPDA
- Top Product
- Discover our top product TRMT2B Primary Antibody
-
-
- Application Notes
-
WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
CXORF34 Blocking Peptide, catalog no. 33R-3146, is also available for use as a blocking control in assays to test for specificity of this CXORF34 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CXORF34 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TRMT2B (tRNA Methyltransferase 2 Homolog B (TRMT2B))
- Alternative Name
- CXORF34 (TRMT2B Products)
- Synonyms
- CXorf34 antibody, dJ341D10.3 antibody, 4732479N06Rik antibody, im:7160396 antibody, wu:fc49d02 antibody, zgc:162982 antibody, tRNA methyltransferase 2 homolog B antibody, TRM2 tRNA methyltransferase 2B antibody, TRMT2B antibody, Trmt2b antibody, trmt2b antibody
- Background
- CXorf34 is a putative methyltransferase.
- Molecular Weight
- 56 kDa (MW of target protein)
-