GMPPB antibody (C-Term)

Catalog No. ABIN629777

Product Details anti-GMPPB Antibody

Target: GMPPB (GDP-Mannose Pyrophosphorylase B (GMPPB))

Binding Specificity: C-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GMPPB antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: GMPPB antibody was raised against the C terminal of GMPPB

Purification: Purified

Immunogen: GMPPB antibody was raised using the C terminal of GMPPB corresponding to a region with amino acids RCRVGQWVRMENVTVLGEDVIVNDELYLNGASVLPHKSIGESVPEPRIIM

Application Details

Application Notes: WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GMPPB Blocking Peptide, catalog no. 33R-7838, is also available for use as a blocking control in assays to test for specificity of this GMPPB antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GMPPB antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for GMPPB

Target: GMPPB (GDP-Mannose Pyrophosphorylase B (GMPPB))

Alternative Name: GMPPB (GMPPB Products)

Synonyms: MDDGA14 antibody, MDDGB14 antibody, MDDGC14 antibody, AI317178 antibody, E430010H19 antibody, RGD1560458 antibody, gmppl antibody, zgc:92026 antibody, GMPPB antibody, gmppb antibody, gmppb-a antibody, gmppb-b antibody, GDP-mannose pyrophosphorylase B antibody, GDP-mannose pyrophosphorylase B L homeolog antibody, GDP-mannose pyrophosphorylase B S homeolog antibody, GMPPB antibody, Gmppb antibody, gmppb antibody, LOAG_13550 antibody, gmppb.L antibody, gmppb.S antibody

Background: GMPPB is a GDP-mannose pyrophosphorylase. This enzyme catalyzes the reaction which converts mannose-1-phosphate and GTP to GDP-mannose which is involved in the production of N-linked oligosaccharides.

Molecular Weight: 43 kDa (MW of target protein)