EEF1G antibody (N-Term)

Catalog No. ABIN629773

Product Details anti-EEF1G Antibody

Target: EEF1G (Eukaryotic Translation Elongation Factor 1 gamma (EEF1G))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This EEF1G antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: EEF1 G antibody was raised against the N terminal of EEF1

Purification: Purified

Immunogen: EEF1 G antibody was raised using the N terminal of EEF1 corresponding to a region with amino acids AAQYSGAQVRVLSAPPHFHFGQTNRTPEFLRKFPAGKVPAFEGDDGFCVF

Application Details

Application Notes: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

EEF1G Blocking Peptide, catalog no. 33R-1044, is also available for use as a blocking control in assays to test for specificity of this EEF1G antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EEF0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for EEF1G

Target: EEF1G (Eukaryotic Translation Elongation Factor 1 gamma (EEF1G))

Alternative Name: EEF1G (EEF1G Products)

Background: EEF1G is a subunit of the elongation factor-1 complex, which is responsible for the enzymatic delivery of aminoacyl tRNAs to the ribosome. This subunit contains an N-terminal glutathione transferase domain, which may be involved in regulating the assembly of multisubunit complexes containing this elongation factor and aminoacyl-tRNA synthetases.

Molecular Weight: 50 kDa (MW of target protein)