PGK1 antibody (C-Term)

Catalog No. ABIN629772

Product Details anti-PGK1 Antibody

Target: PGK1 (Phosphoglycerate Kinase 1 (PGK1))

Binding Specificity: C-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PGK1 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: PGK1 antibody was raised against the C terminal of PGK1

Purification: Purified

Immunogen: PGK1 antibody was raised using the C terminal of PGK1 corresponding to a region with amino acids ATVASGIPAGWMGLDCGPESSKKYAEAVTRAKQIVWNGPVGVFEWEAFAR

Application Details

Application Notes: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PGK1 Blocking Peptide, catalog no. 33R-1574, is also available for use as a blocking control in assays to test for specificity of this PGK1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PGK1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PGK1

Target: PGK1 (Phosphoglycerate Kinase 1 (PGK1))

Alternative Name: PGK1 (PGK1 Products)

Synonyms: MIG10 antibody, PGKA antibody, Pgk-1 antibody, Pgk antibody, PGK antibody, wu:fd59b07 antibody, wu:fj36g06 antibody, zgc:56252 antibody, zgc:77899 antibody, PGK1 antibody, phosphoglycerate kinase 1 antibody, pgk2 antibody, pgka antibody, phosphoglycerate kinase 1 antibody, phosphoglycerate kinase 1 L homeolog antibody, PGK1 antibody, Pgk1 antibody, pgk1 antibody, LOC100348124 antibody, pgk1.L antibody

Background: PGK1 is a glycolytic enzyme that catalyzes the conversion of 1,3-diphosphoglycerate to 3-phosphoglycerate. The protein may also act as a cofactor for polymerase alpha.

Molecular Weight: 44 kDa (MW of target protein)

Pathways: Cellular Glucan Metabolic Process