ACTR2 antibody

Catalog No. ABIN629770

Product Details anti-ACTR2 Antibody

Target: ACTR2 (Actin-Related Protein 2 (ACTR2))

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ACTR2 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Purification: Purified

Immunogen: ACTR2 antibody was raised using a synthetic peptide corresponding to a region with amino acids NGIVRNWDDMKHLWDYTFGPEKLNIDTRNCKILLTEPPMNPTKNREKIVE

Application Details

Application Notes: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ACTR2 Blocking Peptide, catalog no. 33R-6704, is also available for use as a blocking control in assays to test for specificity of this ACTR2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACTR2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ACTR2

Target: ACTR2 (Actin-Related Protein 2 (ACTR2))

Alternative Name: ACTR2 (ACTR2 Products)

Synonyms: ARP2 antibody, 4921510D23Rik antibody, AA409782 antibody, Arp2 antibody, D6Ertd746e antibody, actr2 antibody, hm:zeh1257 antibody, zgc:63719 antibody, actr2-B antibody, arp2-B antibody, arp2 antibody, ACTR2 antibody, DKFZp459N093 antibody, ACTIN RELATED PROTEIN 2 antibody, ATARP2 antibody, WRM antibody, WURM antibody, actin related protein 2 antibody, actr2-A antibody, arp2-A antibody, zgc:110550 antibody, ARP2 actin related protein 2 homolog antibody, ARP2 actin-related protein 2 antibody, ARP2 actin related protein 2a homolog antibody, ARP2 actin-related protein 2 homolog L homeolog antibody, ARP2 actin-related protein 2 homolog antibody, actin-related protein Arp2 antibody, actin related protein 2 antibody, ARP2 actin-related protein 2 homolog S homeolog antibody, ARP2 actin related protein 2b homolog antibody, ARP2/3 actin-organizing complex subunit Arp2 antibody, ACTR2 antibody, Actr2 antibody, actr2a antibody, actr2.L antibody, actr2 antibody, arp2 antibody, ARP2 antibody, actr2.S antibody, actr2b antibody

Background: ACTR2 is known to be a major constituent of the ARP2/3 complex. This complex is located at the cell surface and is essential to cell shape and motility through lamellipodial actin assembly and protrusion.

Molecular Weight: 45 kDa (MW of target protein)

Pathways: RTK Signaling, Regulation of Actin Filament Polymerization