SGPP2 antibody (C-Term)

Catalog No. ABIN629768

Product Details anti-SGPP2 Antibody

Target: SGPP2 (Sphingosine-1-Phosphate Phosphatase 2 (SGPP2))

Binding Specificity: C-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SGPP2 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: SGPP2 antibody was raised against the C terminal of SGPP2

Purification: Purified

Immunogen: SGPP2 antibody was raised using the C terminal of SGPP2 corresponding to a region with amino acids SKPAESLPVIQNIPPLTTYMLVLGLTKFAVGIVLILLVRQLVQNLSLQVL

Application Details

Application Notes: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SGPP2 Blocking Peptide, catalog no. 33R-8562, is also available for use as a blocking control in assays to test for specificity of this SGPP2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SGPP2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SGPP2

Target: SGPP2 (Sphingosine-1-Phosphate Phosphatase 2 (SGPP2))

Alternative Name: SGPP2 (SGPP2 Products)

Synonyms: SPP2 antibody, RGD1565739 antibody, SPPase2 antibody, Spp2 antibody, sphingosine-1-phosphate phosphatase 2 antibody, sphingosine-1-phosphate phosphotase 2 antibody, SGPP2 antibody, Sgpp2 antibody

Background: In vitro, SGPP2 has high phosphohydrolase activity against dihydrosphingosine-1-phosphate and sphingosine-1-phosphate (S1P).

Molecular Weight: 37 kDa (MW of target protein)