ALT antibody

Catalog No. ABIN629766

Product Details anti-ALT Antibody

Target: ALT (Alanine Aminotransferase (ALT))

Reactivity: Human, Rat, Mouse, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ALT antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Purification: Purified

Immunogen: GPT antibody was raised using a synthetic peptide corresponding to a region with amino acids RRVEYAVRGPIVQRALELEQELRQGVKKPFTEVIRANIGDAQAMGQRPIT

Application Details

Application Notes: WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GPT Blocking Peptide, catalog no. 33R-8167, is also available for use as a blocking control in assays to test for specificity of this GPT antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GPT antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ALT

Target: ALT (Alanine Aminotransferase (ALT))

Alternative Name: GPT (ALT Products)

Synonyms: AAT1 antibody, ALT1 antibody, GPT1 antibody, GPT antibody, Gpt1 antibody, An11g02620 antibody, AO090003000164 antibody, 233.t00009 antibody, 24.t00016 antibody, 1300007J06Rik antibody, 2310022B03Rik antibody, ALT antibody, Gpt-1 antibody, AU021132 antibody, Dpagt2 antibody, Gnpta antibody, gpt antibody, ALANINE AMINOTRANSFERAS antibody, AtAlaAT1 antibody, AtAlaATc antibody, T13M22.3 antibody, T13M22_3 antibody, alanine aminotransferas antibody, glutamic--pyruvic transaminase antibody, glutamic-pyruvate transaminase (alanine aminotransferase) antibody, alanine aminotransferase antibody, alanine aminotransferase 1 antibody, glutamic pyruvic transaminase, soluble antibody, dolichyl-phosphate (UDP-N-acetylglucosamine) acetylglucosaminephosphotransferase 1 (GlcNAc-1-P transferase) antibody, alanine aminotransferase 2-like antibody, Alanine aminotransferase 1, mitochondrial antibody, GPT antibody, Gpt antibody, Tb927.1.3950 antibody, ANI_1_368094 antibody, AOR_1_284154 antibody, ALAT_1 antibody, ALAAT1 antibody, EHI_159710 antibody, EHI_096750 antibody, LOC5572541 antibody, ALAT antibody, AAT2 antibody, Dpagt1 antibody, LOC100537633 antibody, AlaAT1 antibody

Background: GPT participates in cellular nitrogen metabolism and also in liver gluconeogenesis starting with precursors transported from skeletal muscles.

Molecular Weight: 55 kDa (MW of target protein)