ALT antibody
-
- Target See all ALT Antibodies
- ALT (Alanine Aminotransferase (ALT))
-
Reactivity
- Human, Rat, Mouse, Dog
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ALT antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Purification
- Purified
- Immunogen
- GPT antibody was raised using a synthetic peptide corresponding to a region with amino acids RRVEYAVRGPIVQRALELEQELRQGVKKPFTEVIRANIGDAQAMGQRPIT
- Top Product
- Discover our top product ALT Primary Antibody
-
-
- Application Notes
-
WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
GPT Blocking Peptide, catalog no. 33R-8167, is also available for use as a blocking control in assays to test for specificity of this GPT antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GPT antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ALT (Alanine Aminotransferase (ALT))
- Alternative Name
- GPT (ALT Products)
- Background
- GPT participates in cellular nitrogen metabolism and also in liver gluconeogenesis starting with precursors transported from skeletal muscles.
- Molecular Weight
- 55 kDa (MW of target protein)
-