PCYT2 antibody (C-Term)

Catalog No. ABIN629765

Product Details anti-PCYT2 Antibody

Target: PCYT2 (Phosphate Cytidylyltransferase 2, Ethanolamine (PCYT2))

Binding Specificity: C-Term

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PCYT2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: PCYT2 antibody was raised against the C terminal of PCYT2

Purification: Purified

Immunogen: PCYT2 antibody was raised using the C terminal of PCYT2 corresponding to a region with amino acids KVDLVCHGKTEIIPDRDGSDPYQEPKRRGIFRQIDSGSNLTTDLIVQRII

Application Details

Application Notes: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PCYT2 Blocking Peptide, catalog no. 33R-4702, is also available for use as a blocking control in assays to test for specificity of this PCYT2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PCYT2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PCYT2

Target: PCYT2 (Phosphate Cytidylyltransferase 2, Ethanolamine (PCYT2))

Alternative Name: PCYT2 (PCYT2 Products)

Synonyms: ET antibody, 1110033E03Rik antibody, ethanolamine-phosphate cytidylyltransferase antibody, putative ethanolamine-phosphate cytidylyltransferase antibody, Ethanolamine-phosphate cytidylyltransferase antibody, phosphate cytidylyltransferase 2, ethanolamine antibody, phosphate cytidylyltransferase 2, ethanolamine L homeolog antibody, Tc00.1047053511727.120 antibody, Tb11.01.5730 antibody, LINJ_32_0940 antibody, LOC5566800 antibody, LMJF_32_0890 antibody, EDI_013070 antibody, EDI_204270 antibody, CpipJ_CPIJ009320 antibody, Bm1_01855 antibody, pcy2 antibody, PCYT2 antibody, Pcyt2 antibody, pcyt2.L antibody

Background: PCYT2 is an enzyme that catalyzes the formation of CDP-ethanolamine from CTP and phosphoethanolamine in the Kennedy pathway of phospholipid synthesis. Alternative splicing results in multiple transcript variants.

Molecular Weight: 43 kDa (MW of target protein)