DECR2 antibody (N-Term)
-
- Target See all DECR2 Antibodies
- DECR2 (2,4-Dienoyl CoA Reductase 2, Peroxisomal (DECR2))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse, Rat, Dog, Zebrafish (Danio rerio)
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This DECR2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- DECR2 antibody was raised against the N terminal of DECR2
- Purification
- Purified
- Immunogen
- DECR2 antibody was raised using the N terminal of DECR2 corresponding to a region with amino acids MAQPPPDVEGDDCLPAYRHLFCPDLLRDKVAFITGGGSGIGFRIAEIFMR
- Top Product
- Discover our top product DECR2 Primary Antibody
-
-
- Application Notes
-
WB: 5 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
DECR2 Blocking Peptide, catalog no. 33R-5726, is also available for use as a blocking control in assays to test for specificity of this DECR2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DECR2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- DECR2 (2,4-Dienoyl CoA Reductase 2, Peroxisomal (DECR2))
- Alternative Name
- DECR2 (DECR2 Products)
- Background
- DECR2 is auxiliary enzyme of beta-oxidation. It participates in the degradation of unsaturated fatty enoyl-CoA esters having double bonds in both even- and odd-numbered positions in peroxisome. It catalyzes the NADP-dependent reduction of 2,4-dienoyl-CoA to yield trans-3-enoyl-CoA and has activity towards short and medium chain 2,4-dienoyl-CoAs, but also towards 2,4,7,10,13,16,19-docosaheptaenoyl-CoA, suggesting that it does not constitute a rate limiting step in the peroxisomal degradation of docosahexaenoic acid.
- Molecular Weight
- 32 kDa (MW of target protein)
-