DECR2 antibody (N-Term)

Catalog No. ABIN629763

Product Details anti-DECR2 Antibody

Target: DECR2 (2,4-Dienoyl CoA Reductase 2, Peroxisomal (DECR2))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat, Dog, Zebrafish (Danio rerio)

Host: Rabbit

Clonality: Polyclonal

Conjugate: This DECR2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: DECR2 antibody was raised against the N terminal of DECR2

Purification: Purified

Immunogen: DECR2 antibody was raised using the N terminal of DECR2 corresponding to a region with amino acids MAQPPPDVEGDDCLPAYRHLFCPDLLRDKVAFITGGGSGIGFRIAEIFMR

Application Details

Application Notes: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

DECR2 Blocking Peptide, catalog no. 33R-5726, is also available for use as a blocking control in assays to test for specificity of this DECR2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DECR2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for DECR2

Target: DECR2 (2,4-Dienoyl CoA Reductase 2, Peroxisomal (DECR2))

Alternative Name: DECR2 (DECR2 Products)

Synonyms: PDCR antibody, SDR17C1 antibody, zC153C20.5 antibody, zgc:85626 antibody, Dcrakl antibody, putativeperoxisomal24-dienoyl-CoAreductase antibody, 2,4-dienoyl-CoA reductase 2 antibody, 2,4-dienoyl CoA reductase 2, peroxisomal antibody, 2,4-dienoyl-CoA reductase 2 L homeolog antibody, 2-4-dienoyl-Coenzyme A reductase 2, peroxisomal antibody, DECR2 antibody, decr2 antibody, decr2.L antibody, Decr2 antibody

Background: DECR2 is auxiliary enzyme of beta-oxidation. It participates in the degradation of unsaturated fatty enoyl-CoA esters having double bonds in both even- and odd-numbered positions in peroxisome. It catalyzes the NADP-dependent reduction of 2,4-dienoyl-CoA to yield trans-3-enoyl-CoA and has activity towards short and medium chain 2,4-dienoyl-CoAs, but also towards 2,4,7,10,13,16,19-docosaheptaenoyl-CoA, suggesting that it does not constitute a rate limiting step in the peroxisomal degradation of docosahexaenoic acid.

Molecular Weight: 32 kDa (MW of target protein)