SARDH antibody (Middle Region)

Catalog No. ABIN629761

Product Details anti-SARDH Antibody

Target: SARDH (Sarcosine Dehydrogenase (SARDH))

Binding Specificity: Middle Region

Reactivity: Mouse, Rat, Human, Dog, Zebrafish (Danio rerio)

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SARDH antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: SARDH antibody was raised against the middle region of SARDH

Purification: Purified

Immunogen: SARDH antibody was raised using the middle region of SARDH corresponding to a region with amino acids DHPRWIRERSHESYAKNYSVVFPHDEPLAGRNMRRDPLHEELLGQGCVFQ

Application Details

Application Notes: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SARDH Blocking Peptide, catalog no. 33R-1982, is also available for use as a blocking control in assays to test for specificity of this SARDH antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SARDH antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SARDH

Target: SARDH (Sarcosine Dehydrogenase (SARDH))

Alternative Name: SARDH (SARDH Products)

Background: The protein encoded by this gene is an enzyme localized to the mitochondrial matrix which catalyzes the oxidative demethylation of sarcosine. This enzyme is distinct from another mitochondrial matrix enzyme, dimethylglycine dehydrogenase, which catalyzes a reaction resulting in the formation of sarcosine. Mutations in this gene are associated with sarcosinemia.

Molecular Weight: 67 kDa (MW of target protein)