SMPX antibody (Middle Region)

Catalog No. ABIN629759

Product Details anti-SMPX Antibody

Target: SMPX (Small Muscle Protein, X-Linked (SMPX))

Binding Specificity: Middle Region

Reactivity: Human, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SMPX antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: SMPX antibody was raised against the middle region of SMPX

Purification: Purified

Immunogen: SMPX antibody was raised using the middle region of SMPX corresponding to a region with amino acids TPEVEEGVPPTSDEEKKPIPGAKKLPGPAVNLSEIQNIKSELKYVPKAEQ

Application Details

Application Notes: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SMPX Blocking Peptide, catalog no. 33R-9221, is also available for use as a blocking control in assays to test for specificity of this SMPX antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SMPX antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SMPX

Target: SMPX (Small Muscle Protein, X-Linked (SMPX))

Alternative Name: SMPX (SMPX Products)

Synonyms: DFNX4 antibody, 1010001C09Rik antibody, Csl antibody, small muscle protein, X-linked antibody, SMPX antibody, Smpx antibody

Background: SMPX plays a role in the regulatory network through which muscle cells coordinate their structural and functional states during growth, adaptation, and repair.

Molecular Weight: 9 kDa (MW of target protein)