SIK1 antibody (N-Term)
-
- Target See all SIK1 Antibodies
- SIK1 (Salt-Inducible Kinase 1 (SIK1))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SIK1 antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificity
- SNF1 LK antibody was raised against the N terminal of SNF1 K
- Purification
- Purified
- Immunogen
- SNF1 LK antibody was raised using the N terminal of SNF1 K corresponding to a region with amino acids MVIMSEFSADPAGQGQGQQKPLRVGFYDIERTLGKGNFAVVKLARHRVTK
- Top Product
- Discover our top product SIK1 Primary Antibody
-
anti-Salt-Inducible Kinase 1 (SIK1) (AA 567-597), (C-Term) antibody
SIK1 Reactivity: Human, Mouse WB, IHC (p) Host: Rabbit Polyclonal RB3576 unconjugated
anti-Salt-Inducible Kinase 1 (SIK1) (AA 1-783) antibodySIK1 Reactivity: Human WB, IF Host: Rabbit Polyclonal unconjugated
anti-Salt-Inducible Kinase 1 (SIK1) (AA 1-100) antibodySIK1 Reactivity: Human ELISA, IF, IHC (p) Host: Mouse Monoclonal 2C12 unconjugated
anti-Salt-Inducible Kinase 1 (SIK1) (AA 492-750) antibodySIK1 Reactivity: Human ELISA, IHC, IF Host: Rabbit Polyclonal unconjugated
anti-Salt-Inducible Kinase 1 (SIK1) (N-Term) antibodySIK1 Reactivity: Human, Horse, Cow, Xenopus laevis WB, IHC, IHC (p) Host: Rabbit Polyclonal unconjugated
anti-Salt-Inducible Kinase 1 (SIK1) (AA 1-783) antibodySIK1 Reactivity: Human WB, IF Host: Mouse Polyclonal unconjugated
anti-Salt-Inducible Kinase 1 (SIK1) (AA 1-101) antibodySIK1 Reactivity: Human ELISA, IHC, IHC (p) Host: Mouse Monoclonal 2C12 unconjugated
anti-Salt-Inducible Kinase 1 (SIK1) (N-Term) antibodySIK1 Reactivity: Human, Mouse, Rat, Horse, Dog, Guinea Pig, Cow, Pig, Rabbit WB, IHC Host: Rabbit Polyclonal unconjugated
anti-Salt-Inducible Kinase 1 (SIK1) (AA 51-150) antibodySIK1 Reactivity: Human, Mouse WB, ELISA, FACS Host: Rabbit Polyclonal unconjugated
anti-Salt-Inducible Kinase 1 (SIK1) (Tyr86) antibodySIK1 Reactivity: Human, Rat WB, ELISA Host: Rabbit Polyclonal unconjugated
-
- Application Notes
-
WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SNF1LK Blocking Peptide, catalog no. 33R-6587, is also available for use as a blocking control in assays to test for specificity of this SNF1LK antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SNF0 K antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SIK1 (Salt-Inducible Kinase 1 (SIK1))
- Alternative Name
- SNF1LK (SIK1 Products)
- Synonyms
- Msk antibody, Sik antibody, Snf1lk antibody, SIK2 antibody, SNF1LK antibody, MSK antibody, SIK antibody, salt-inducible kinase 1 antibody, salt inducible kinase 1 antibody, SIK1 antibody, Sik1 antibody
- Background
- SNF1LK play a transient role during the earliest stages of myocardial cell differentiation and/or primitive chamber formation and may also be important for the earliest stages of skeletal muscle growth and/or differentiation. It also plays a potential role in G2/M cell cycle regulation. It inhibits CREB activity by phosphorylating and repressing the CREB-specific coactivators, CRTC1-3.
- Molecular Weight
- 85 kDa (MW of target protein)
- Pathways
- Regulation of Muscle Cell Differentiation, Skeletal Muscle Fiber Development, Regulation of Carbohydrate Metabolic Process
-
