SBDS antibody (C-Term)

Catalog No. ABIN629754

Product Details anti-SBDS Antibody

Target: SBDS (Shwachman-Bodian-Diamond Syndrome (SBDS))

Binding Specificity: C-Term

Reactivity: Human, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SBDS antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: SBDS antibody was raised against the C terminal of SBDS

Purification: Purified

Immunogen: SBDS antibody was raised using the C terminal of SBDS corresponding to a region with amino acids DYGQQLEIVCLIDPGCFREIDELIKKETKGKGSLEVLNLKDVEEGDEKFE

Application Details

Application Notes: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SBDS Blocking Peptide, catalog no. 33R-2237, is also available for use as a blocking control in assays to test for specificity of this SBDS antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SBDS antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SBDS

Target: SBDS (Shwachman-Bodian-Diamond Syndrome (SBDS))

Alternative Name: SBDS (SBDS Products)

Synonyms: cgi-97 antibody, sds antibody, swds antibody, zgc:56700 antibody, SDS antibody, SWDS antibody, 4733401P19Rik antibody, AI836084 antibody, CGI-97 antibody, SBDS ribosome assembly guanine nucleotide exchange factor antibody, hypothetical protein antibody, SBDS, ribosome maturation factor antibody, SBDS ribosome assembly guanine nucleotide exchange factor S homeolog antibody, SBDS ribosome maturation factor antibody, sbds antibody, LOAG_04440 antibody, sbds.S antibody, SBDS antibody, Sbds antibody

Background: SBDS is a member of a highly conserved protein family that exists from archaea to vertebrates and plants. The protein may function in RNA metabolism. Mutations within its gene are associated with Shwachman-Bodian-Diamond syndrome.

Molecular Weight: 28 kDa (MW of target protein)

Pathways: Ribonucleoprotein Complex Subunit Organization, Ribosome Assembly