Cytokeratin 13 antibody (C-Term)

Catalog No. ABIN629751

Product Details anti-Cytokeratin 13 Antibody

Target: Cytokeratin 13 (KRT13) (Keratin 13 (KRT13))

Binding Specificity: C-Term

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Cytokeratin 13 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: Cytokeratin 13 antibody was raised against the C terminal of KRT13

Purification: Purified

Immunogen: Cytokeratin 13 antibody was raised using the C terminal of KRT13 corresponding to a region with amino acids EAQLSELRSEMECQNQEYKMLLDIKTRLEQEIATYRSLLEGQDAKKRQPP

Application Details

Application Notes: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Cytokeratin 13 Blocking Peptide, catalog no. 33R-2277, is also available for use as a blocking control in assays to test for specificity of this Cytokeratin 13 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KRT13 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Cytokeratin 13

Target: Cytokeratin 13 (KRT13) (Keratin 13 (KRT13))

Alternative Name: Cytokeratin 13 (KRT13 Products)

Synonyms: krt13 antibody, CK13 antibody, K13 antibody, Ka13 antibody, Krt-1.13 antibody, Krt1-13 antibody, ck13 antibody, k13 antibody, keratin 24 antibody, keratin 13 antibody, keratin 13, type I S homeolog antibody, krt24 antibody, KRT13 antibody, Krt13 antibody, krt13.S antibody, k13 antibody

Background: KRT13 is a member of the keratin gene family. The keratins are intermediate filament proteins responsible for the structural integrity of epithelial cells and are subdivided into cytokeratins and hair keratins. Most of the type I cytokeratins consist of acidic proteins which are arranged in pairs of heterotypic keratin chains. This type I cytokeratin is paired with keratin 4 and expressed in the suprabasal layers of non-cornified stratified epithelia.

Molecular Weight: 46 kDa (MW of target protein)