ASL antibody (Middle Region)

Catalog No. ABIN629749

Product Details anti-ASL Antibody

Target: ASL (Argininosuccinate Lyase (ASL))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ASL antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: ASL antibody was raised against the middle region of ASL

Purification: Purified

Immunogen: ASL antibody was raised using the middle region of ASL corresponding to a region with amino acids LILYCTKEFSFVQLSDAYSTGSSLMPQKKNPDSLELIRSKAGRVFGREDK

Application Details

Application Notes: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ASL Blocking Peptide, catalog no. 33R-5053, is also available for use as a blocking control in assays to test for specificity of this ASL antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ASL antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ASL

Target: ASL (Argininosuccinate Lyase (ASL))

Alternative Name: ASL (ASL Products)

Synonyms: ASAL antibody, 2510006M18Rik antibody, zgc:63532 antibody, BA4879 antibody, PSPTO0125 antibody, Adl antibody, Asl antibody, argininosuccinate lyase antibody, argininosuccinate lyase ArgH antibody, adenylosuccinate lyase antibody, argininosuccinate lyase L homeolog antibody, ASL antibody, Asl antibody, asl antibody, argH2 antibody, argH antibody, arg7 antibody, CNC04420 antibody, STHERM_c13370 antibody, Adsl antibody, asl.L antibody, ARG7 antibody

Background: ASL is a member of the lyase 1 family. The protein forms a cytosolic homotetramer and primarily catalyzes the reversible hydrolytic cleavage of argininosuccinate into arginine and fumarate, an essential step in the liver in detoxifying ammonia via the urea cycle. Mutations in its gene result in the autosomal recessive disorder argininosuccinic aciduria, or argininosuccinic acid lyase deficiency.

Molecular Weight: 49 kDa (MW of target protein)

Pathways: Response to Growth Hormone Stimulus