BHMT antibody (C-Term)
-
- Target See all BHMT Antibodies
- BHMT (Betaine--Homocysteine S-Methyltransferase (BHMT))
-
Binding Specificity
- C-Term
-
Reactivity
- Human, Dog
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This BHMT antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificity
- BHMT antibody was raised against the C terminal of BHMT
- Purification
- Purified
- Immunogen
- BHMT antibody was raised using the C terminal of BHMT corresponding to a region with amino acids KHGSWGSGLDMHTKPWVRARARKEYWENLRIASGRPYNPSMSKPDGWGVT
- Top Product
- Discover our top product BHMT Primary Antibody
-
-
- Application Notes
-
WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
BHMT Blocking Peptide, catalog no. 33R-4414, is also available for use as a blocking control in assays to test for specificity of this BHMT antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BHMT antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- BHMT (Betaine--Homocysteine S-Methyltransferase (BHMT))
- Alternative Name
- BHMT (BHMT Products)
- Synonyms
- BHMT1 antibody, hm:zehn2153 antibody, wu:fb53h01 antibody, wu:fb63c08 antibody, wu:fj64d01 antibody, zgc:123027 antibody, betaine--homocysteine S-methyltransferase antibody, betaine--homocysteine S-methyltransferase L homeolog antibody, betaine-homocysteine methyltransferase antibody, betaine-homocysteine S-methyltransferase antibody, BHMT antibody, bhmt.L antibody, Bhmt antibody, bhmt antibody
- Background
- BHMT is a cytosolic enzyme that catalyzes the conversion of betaine and homocysteine to dimethylglycine and methionine, respectively. Defects in its gene could lead to hyperhomocyst(e)inemia, but such a defect has not yet been observed.
- Molecular Weight
- 45 kDa (MW of target protein)
- Pathways
- Methionine Biosynthetic Process
-