DPYS antibody (Middle Region)
-
- Target See all DPYS Antibodies
- DPYS (Dihydropyrimidinase (DPYS))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This DPYS antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- DPYS antibody was raised against the middle region of DPYS
- Purification
- Purified
- Immunogen
- DPYS antibody was raised using the middle region of DPYS corresponding to a region with amino acids LRPDPSTPDFLMNLLANDDLTTTGTDNCTFNTCQKALGKDDFTKIPNGVN
- Top Product
- Discover our top product DPYS Primary Antibody
-
-
- Application Notes
-
WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
DPYS Blocking Peptide, catalog no. 33R-5375, is also available for use as a blocking control in assays to test for specificity of this DPYS antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DPYS antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- DPYS (Dihydropyrimidinase (DPYS))
- Alternative Name
- DPYS (DPYS Products)
- Synonyms
- DHP antibody, DHPase antibody, 1200017I10Rik antibody, 1300004I01Rik antibody, dhp antibody, dihydropyrimidinase antibody, dihydropyrimidinase L homeolog antibody, DPYS antibody, Dpys antibody, Jann_1488 antibody, hydA antibody, h16_A3075 antibody, Veis_0725 antibody, AZC_1966 antibody, M446_2543 antibody, RSKD131_3628 antibody, Vapar_5601 antibody, Rleg_5687 antibody, LOC9307588 antibody, EIO_3239 antibody, blr3333 antibody, BAV0676 antibody, hyuA antibody, CtCNB1_2936 antibody, dpyS antibody, Pat9b_1914 antibody, dpys antibody, dpys.L antibody
- Background
- Dihydropyrimidinase catalyzes the conversion of 5,6-dihydrouracil to 3-ureidopropionate in pyrimidine metabolism. Dihydropyrimidinase is expressed at a high level in liver and kidney as a major 2.5-kb transcript and a minor 3.8-kb transcript. Defects in the DPYS gene are linked to dihydropyrimidinuria.Dihydropyrimidinase catalyzes the conversion of 5,6-dihydrouracil to 3-ureidopropionate in pyrimidine metabolism. Dihydropyrimidinase is expressed at a high level in liver and kidney as a major 2.5-kb transcript and a minor 3.8-kb transcript. Defects in the DPYS gene are linked to dihydropyrimidinuria.
- Molecular Weight
- 56 kDa (MW of target protein)
-