DPYS antibody (N-Term)

Catalog No. ABIN629746

Product Details anti-DPYS Antibody

Target: DPYS (Dihydropyrimidinase (DPYS))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This DPYS antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: DPYS antibody was raised against the N terminal of DPYS

Purification: Purified

Immunogen: DPYS antibody was raised using the N terminal of DPYS corresponding to a region with amino acids VLDAAGKLVLPGGIDTHTHMQFPFMGSRSIDDFHQGTKAALSGGTTMIID

Application Details

Application Notes: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

DPYS Blocking Peptide, catalog no. 33R-9643, is also available for use as a blocking control in assays to test for specificity of this DPYS antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DPYS antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for DPYS

Target: DPYS (Dihydropyrimidinase (DPYS))

Alternative Name: DPYS (DPYS Products)

Synonyms: DHP antibody, DHPase antibody, 1200017I10Rik antibody, 1300004I01Rik antibody, dhp antibody, dihydropyrimidinase antibody, dihydropyrimidinase L homeolog antibody, DPYS antibody, Dpys antibody, Jann_1488 antibody, hydA antibody, h16_A3075 antibody, Veis_0725 antibody, AZC_1966 antibody, M446_2543 antibody, RSKD131_3628 antibody, Vapar_5601 antibody, Rleg_5687 antibody, LOC9307588 antibody, EIO_3239 antibody, blr3333 antibody, BAV0676 antibody, hyuA antibody, CtCNB1_2936 antibody, dpyS antibody, Pat9b_1914 antibody, dpys antibody, dpys.L antibody

Background: Dihydropyrimidinase catalyzes the conversion of 5,6-dihydrouracil to 3-ureidopropionate in pyrimidine metabolism. Dihydropyrimidinase is expressed at a high level in liver and kidney as a major 2.5-kb transcript and a minor 3.8-kb transcript. Defects in the DPYS gene are linked to dihydropyrimidinuria.Dihydropyrimidinase catalyzes the conversion of 5,6-dihydrouracil to 3-ureidopropionate in pyrimidine metabolism. Dihydropyrimidinase is expressed at a high level in liver and kidney as a major 2.5-kb transcript and a minor 3.8-kb transcript. Defects in the DPYS gene are linked to dihydropyrimidinuria.

Molecular Weight: 56 kDa (MW of target protein)