MAT1A antibody (N-Term)

Catalog No. ABIN629745

Product Details anti-MAT1A Antibody

Target: MAT1A (Methionine Adenosyltransferase I, alpha (MAT1A))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat, Dog, Drosophila melanogaster, C. elegans

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MAT1A antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: MAT1 A antibody was raised against the N terminal of MAT1

Purification: Purified

Immunogen: MAT1 A antibody was raised using the N terminal of MAT1 corresponding to a region with amino acids TSESVGEGHPDKICDQISDAVLDAHLKQDPNAKVACETVCKTGMVLLCGE

Application Details

Application Notes: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MAT1A Blocking Peptide, catalog no. 33R-9282, is also available for use as a blocking control in assays to test for specificity of this MAT1A antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MAT0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MAT1A

Target: MAT1A (Methionine Adenosyltransferase I, alpha (MAT1A))

Alternative Name: MAT1A (MAT1A Products)

Synonyms: MAT antibody, MATA1 antibody, SAMS antibody, SAMS1 antibody, AdoMet antibody, SADE antibody, SAS antibody, AI046368 antibody, Ams antibody, wu:fi35e01 antibody, zgc:55442 antibody, methionine adenosyltransferase 1A antibody, methionine adenosyltransferase I, alpha antibody, MAT1A antibody, Mat1a antibody, mat1a antibody

Background: MAT1A catalyzes the formation of S-adenosylmethionine from methionine and ATP. Methionine adenosyltransferase deficiency is caused by recessive and dominant mutations, the latter identified in autosomal dominant persistant hypermethioninemia.

Molecular Weight: 43 kDa (MW of target protein)

Pathways: Mitotic G1-G1/S Phases, M Phase, Ribonucleoside Biosynthetic Process, Methionine Biosynthetic Process