RNF39 antibody (C-Term)
-
- Target See all RNF39 Antibodies
- RNF39 (Ring Finger Protein 39 (RNF39))
-
Binding Specificity
- C-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This RNF39 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- RNF39 antibody was raised against the C terminal of RNF39
- Purification
- Purified
- Immunogen
- RNF39 antibody was raised using the C terminal of RNF39 corresponding to a region with amino acids CRSINSNPHFRPKIMRPHLVSTFPRPCSKPNPFLPSGSQNLLSPTATTVL
- Top Product
- Discover our top product RNF39 Primary Antibody
-
-
- Application Notes
-
WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
RNF39 Blocking Peptide, catalog no. 33R-1798, is also available for use as a blocking control in assays to test for specificity of this RNF39 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RNF39 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RNF39 (Ring Finger Protein 39 (RNF39))
- Alternative Name
- RNF39 (RNF39 Products)
- Background
- Its gene lies within the major histocompatibility complex class I region on chromosome 6. Studies of a similar rat protein suggest that RNF39 plays a role in an early phase of synaptic plasticity. Its gene lies within the major histocompatibility complex class I region on chromosome 6.
- Molecular Weight
- 28 kDa (MW of target protein)
-