LONRF1 antibody (N-Term)

Catalog No. ABIN629741

Product Details anti-LONRF1 Antibody

Target: LONRF1 (LON Peptidase N-terminal Domain and Ring Finger 1 (LONRF1))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This LONRF1 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: LONRF1 antibody was raised against the N terminal of LONRF1

Purification: Purified

Immunogen: LONRF1 antibody was raised using the N terminal of LONRF1 corresponding to a region with amino acids MSSPAVARTSPGGSREMAPAPQGRGRFWEVGGGSGHRLERAAAESERWEL

Application Details

Application Notes: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

LONRF1 Blocking Peptide, catalog no. 33R-6504, is also available for use as a blocking control in assays to test for specificity of this LONRF1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LONRF1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for LONRF1

Target: LONRF1 (LON Peptidase N-terminal Domain and Ring Finger 1 (LONRF1))

Alternative Name: LONRF1 (LONRF1 Products)

Synonyms: RGD1562583 antibody, LONRF1 antibody, RNF191 antibody, LON peptidase N-terminal domain and ring finger 1 antibody, LON peptidase N-terminal domain and RING finger protein 1 antibody, Lonrf1 antibody, LONRF1 antibody, LOC567909 antibody, lonrf1 antibody

Background: LONRF1 is involved in protein binding, zinc ion binding, ATP-dependent peptidase activity and metal ion binding.

Molecular Weight: 46 kDa (MW of target protein)