RNF32 antibody (Middle Region)
-
- Target See all RNF32 Antibodies
- RNF32 (Ring Finger Protein 32 (RNF32))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Rat, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This RNF32 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- RNF32 antibody was raised against the middle region of RNF32
- Purification
- Purified
- Immunogen
- RNF32 antibody was raised using the middle region of RNF32 corresponding to a region with amino acids ACLQAFEKFTNKKTCPLCRKNQYQTRVIHDGARLFRIKCVTRIQAYWRGC
- Top Product
- Discover our top product RNF32 Primary Antibody
-
-
- Application Notes
-
WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
RNF32 Blocking Peptide, catalog no. 33R-1073, is also available for use as a blocking control in assays to test for specificity of this RNF32 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RNF32 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RNF32 (Ring Finger Protein 32 (RNF32))
- Alternative Name
- RNF32 (RNF32 Products)
- Synonyms
- zgc:153042 antibody, FKSG33 antibody, HSD15 antibody, LMBR2 antibody, 1700009J01Rik antibody, 2700025B22Rik antibody, 4930542N22Rik antibody, Lmbr2 antibody, ring finger protein 32 antibody, rnf32 antibody, RNF32 antibody, Rnf32 antibody
- Background
- RNF32 contains two RING ring finger motifs. RING finger motifs are present in a variety of functionally distinct proteins and are known to be involved in protein-DNA or protein-protein interactions. Its gene was found to be expressed during spermatogenesis, most likely in spermatocytes and/or in spermatids.
- Molecular Weight
- 40 kDa (MW of target protein)
-