RNF32 antibody (Middle Region)

Catalog No. ABIN629739

Product Details anti-RNF32 Antibody

Target: RNF32 (Ring Finger Protein 32 (RNF32))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RNF32 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: RNF32 antibody was raised against the middle region of RNF32

Purification: Purified

Immunogen: RNF32 antibody was raised using the middle region of RNF32 corresponding to a region with amino acids ACLQAFEKFTNKKTCPLCRKNQYQTRVIHDGARLFRIKCVTRIQAYWRGC

Application Details

Application Notes: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RNF32 Blocking Peptide, catalog no. 33R-1073, is also available for use as a blocking control in assays to test for specificity of this RNF32 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RNF32 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RNF32

Target: RNF32 (Ring Finger Protein 32 (RNF32))

Alternative Name: RNF32 (RNF32 Products)

Synonyms: zgc:153042 antibody, FKSG33 antibody, HSD15 antibody, LMBR2 antibody, 1700009J01Rik antibody, 2700025B22Rik antibody, 4930542N22Rik antibody, Lmbr2 antibody, ring finger protein 32 antibody, rnf32 antibody, RNF32 antibody, Rnf32 antibody

Background: RNF32 contains two RING ring finger motifs. RING finger motifs are present in a variety of functionally distinct proteins and are known to be involved in protein-DNA or protein-protein interactions. Its gene was found to be expressed during spermatogenesis, most likely in spermatocytes and/or in spermatids.

Molecular Weight: 40 kDa (MW of target protein)