FBXL7 antibody (N-Term)

Catalog No. ABIN629737

Product Details anti-FBXL7 Antibody

Target: FBXL7 (F-Box and Leucine-Rich Repeat Protein 7 (FBXL7))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FBXL7 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: FBXL7 antibody was raised against the N terminal of FBXL7

Purification: Purified

Immunogen: FBXL7 antibody was raised using the N terminal of FBXL7 corresponding to a region with amino acids IRLASRPQKEQASIDRLPDHSMVQIFSFLPTNQLCRCARVCRRWYNLAWD

Application Details

Application Notes: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

FBXL7 Blocking Peptide, catalog no. 33R-4136, is also available for use as a blocking control in assays to test for specificity of this FBXL7 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FBXL7 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for FBXL7

Target: FBXL7 (F-Box and Leucine-Rich Repeat Protein 7 (FBXL7))

Alternative Name: FBXL7 (FBXL7 Products)

Synonyms: FBXL7 antibody, FBL6 antibody, FBL7 antibody, AL023057 antibody, D230018M15Rik antibody, Fbl6 antibody, F-box and leucine rich repeat protein 7 antibody, F-box and leucine-rich repeat protein 7 antibody, FBXL7 antibody, Fbxl7 antibody

Background: FBXL7 is a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs.

Molecular Weight: 54 kDa (MW of target protein)