FBXO25 antibody (C-Term)

Catalog No. ABIN629736

Product Details anti-FBXO25 Antibody

Target: FBXO25 (F-Box Protein 25 (FBXO25))

Binding Specificity: C-Term

Reactivity: Human, Dog, Zebrafish (Danio rerio)

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FBXO25 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: FBXO25 antibody was raised against the C terminal of FBXO25

Purification: Purified

Immunogen: FBXO25 antibody was raised using the C terminal of FBXO25 corresponding to a region with amino acids AKEQYGDTLHFCRHCSILFWKDSGHPCTAADPDSCFTPVSPQHFIDLFKF

Application Details

Application Notes: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

FBXO25 Blocking Peptide, catalog no. 33R-1290, is also available for use as a blocking control in assays to test for specificity of this FBXO25 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FBXO25 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for FBXO25

Target: FBXO25 (F-Box Protein 25 (FBXO25))

Alternative Name: FBXO25 (FBXO25 Products)

Synonyms: FBXO25 antibody, fbxo32 antibody, MGC108443 antibody, DKFZp469H2437 antibody, zgc:100907 antibody, FBX25 antibody, 9130015I06Rik antibody, AI649137 antibody, Fbx25 antibody, F-box protein 25 antibody, F-box protein 25 L homeolog antibody, FBXO25 antibody, fbxo25 antibody, fbxo25.L antibody, Fbxo25 antibody

Background: FBXO25 is a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. FBXO25 belongs to the Fbxs class.

Molecular Weight: 16 kDa (MW of target protein)