UBE2D1 antibody

Catalog No. ABIN629731

Product Details anti-UBE2D1 Antibody

Target: UBE2D1 (Ubiquitin-Conjugating Enzyme E2D 1 (UBE2D1))

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This UBE2D1 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Purified

Immunogen: UBE2 D1 antibody was raised using a synthetic peptide corresponding to a region with amino acids SQWSPALTVSKVLLSICSLLCDPNPDDPLVPDIAQIYKSDKEKYNRHARE

Application Details

Application Notes: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

UBE2D1 Blocking Peptide, catalog no. 33R-8734, is also available for use as a blocking control in assays to test for specificity of this UBE2D1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UBE0 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for UBE2D1

Target: UBE2D1 (Ubiquitin-Conjugating Enzyme E2D 1 (UBE2D1))

Alternative Name: UBE2D1 (UBE2D1 Products)

Synonyms: E2(17)KB1 antibody, SFT antibody, UBC4/5 antibody, UBCH5 antibody, UBCH5A antibody, ube2d1 antibody, wu:fc16h06 antibody, zgc:73096 antibody, e2(17)kb1 antibody, sft antibody, ubc4/5 antibody, ubch5 antibody, ubch5a antibody, ubiquitin conjugating enzyme E2 D1 antibody, ubiquitin-conjugating enzyme E2D 1 antibody, ubiquitin-conjugating enzyme E2D 1b antibody, ubiquitin conjugating enzyme E2 D1 S homeolog antibody, UBE2D1 antibody, Ube2d1 antibody, ube2d1b antibody, ube2d1.S antibody, ube2d1 antibody

Background: The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. UBE2D1 is a member of the E2 ubiquitin-conjugating enzyme family. This enzyme is closely related to a stimulator of iron transport (SFT), and is up-regulated in hereditary hemochromatosis. It also functions in the ubiquitination of the tumor-suppressor protein p53 and the hypoxia-inducible transcription factor HIF1alpha by interacting with the E1 ubiquitin-activating enzyme and the E3 ubiquitin-protein ligases.

Molecular Weight: 16 kDa (MW of target protein)

Pathways: Activation of Innate immune Response, Toll-Like Receptors Cascades