CDC23 antibody

Catalog No. ABIN629729

Product Details anti-CDC23 Antibody

Target: CDC23 (Cell Division Cycle 23 (CDC23))

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CDC23 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Purified

Immunogen: CDC23 antibody was raised using a synthetic peptide corresponding to a region with amino acids RAAHFLHGCNSKKAYFLYMYSRYLSGEKKKDDETVDSLGPLEKGQVKNEA

Application Details

Application Notes: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CDC23 Blocking Peptide, catalog no. 33R-7799, is also available for use as a blocking control in assays to test for specificity of this CDC23 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CDC23 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CDC23

Target: CDC23 (Cell Division Cycle 23 (CDC23))

Alternative Name: CDC23 (CDC23 Products)

Background: CDC23 shares strong similarity with Saccharomyces cerevisiae Cdc23, a protein essential for cell cycle progression through the G2/M transition. This protein is a component of anaphase-promoting complex (APC), which is composed of eight protein subunits and highly conserved in eukaryotic cells. APC catalyzes the formation of cyclin B-ubiquitin conjugate that is responsible for the ubiquitin-mediated proteolysis of B-type cyclins. This protein and 3 other members of the APC complex contain the TPR (tetratricopeptide repeat), a protein domain important for protein-protein interaction.

Molecular Weight: 66 kDa (MW of target protein)

Pathways: Protein targeting to Nucleus