BSDC1 antibody (N-Term)

Catalog No. ABIN629726

Product Details anti-BSDC1 Antibody

Target: BSDC1 (BSD Domain Containing 1 (BSDC1))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Dog, Rat, Zebrafish (Danio rerio)

Host: Rabbit

Clonality: Polyclonal

Conjugate: This BSDC1 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: BSDC1 antibody was raised against the N terminal of BSDC1

Purification: Purified

Immunogen: BSDC1 antibody was raised using the N terminal of BSDC1 corresponding to a region with amino acids VISDTFAPSPDKTIDCDVITLMGTPSGTAEPYDGTKARLYSLQSDPATYC

Application Details

Application Notes: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

BSDC1 Blocking Peptide, catalog no. 33R-9610, is also available for use as a blocking control in assays to test for specificity of this BSDC1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BSDC1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for BSDC1

Target: BSDC1 (BSD Domain Containing 1 (BSDC1))

Alternative Name: BSDC1 (BSDC1 Products)

Synonyms: BSDC1 antibody, fb51h12 antibody, wu:fb51h12 antibody, zgc:100785 antibody, bsdc1 antibody, 1110063F24Rik antibody, AW011758 antibody, RGD1311622 antibody, BSD domain containing 1 antibody, BSD domain containing 1 L homeolog antibody, BSDC1 antibody, bsdc1 antibody, bsdc1.L antibody, Bsdc1 antibody

Background: BSDC1 may be involved in protein binding.

Molecular Weight: 17 kDa (MW of target protein)