RNF165 antibody (N-Term)

Catalog No. ABIN629725

Product Details anti-RNF165 Antibody

Target: RNF165 (Ring Finger Protein 165 (RNF165))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RNF165 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: RNF165 antibody was raised against the N terminal of RNF165

Purification: Purified

Immunogen: RNF165 antibody was raised using the N terminal of RNF165 corresponding to a region with amino acids MVLVHVGYLVLPVFGSVRNRGAPFQRSQHPHATSCRHFHLGPPQPQQLAP

Application Details

Application Notes: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RNF165 Blocking Peptide, catalog no. 33R-6596, is also available for use as a blocking control in assays to test for specificity of this RNF165 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RNF165 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RNF165

Target: RNF165 (Ring Finger Protein 165 (RNF165))

Alternative Name: RNF165 (RNF165 Products)

Synonyms: RNF165 antibody, ARKL2 antibody, 2900024M11Rik antibody, AI427432 antibody, G630064H08Rik antibody, Gm96 antibody, RGD1560744 antibody, si:ch73-29c22.3 antibody, ring finger protein 165 antibody, ring finger protein 165a antibody, RNF165 antibody, Rnf165 antibody, rnf165a antibody

Background: RNF165 is encoded in regions involved in pericentric inversions in patients with bipolar affective disorder.Encoded in regions involved in pericentric inversions in patients with bipolar affective disorder.Encoded in regions involved in pericentric inversions in patients with bipolar affective disorder.

Molecular Weight: 39 kDa (MW of target protein)