UBE2K antibody (N-Term)

Catalog No. ABIN629721

Product Details anti-UBE2K Antibody

Target: UBE2K (Ubiquitin-Conjugating Enzyme E2K (UBE2K))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat, Zebrafish (Danio rerio), Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This UBE2K antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: HIP2 antibody was raised against the N terminal of HIP2

Purification: Purified

Immunogen: HIP2 antibody was raised using the N terminal of HIP2 corresponding to a region with amino acids MANIAVQRIKREFKEVLKSEETSKNQIKVDLVDENFTELRGEIAGPPDTP

Application Details

Application Notes: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

HIP2 Blocking Peptide, catalog no. 33R-5707, is also available for use as a blocking control in assays to test for specificity of this HIP2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HIP2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for UBE2K

Target: UBE2K (Ubiquitin-Conjugating Enzyme E2K (UBE2K))

Alternative Name: HIP2 (UBE2K Products)

Synonyms: E2-25K antibody, HIP2 antibody, HYPG antibody, LIG antibody, UBC1 antibody, E2-25k antibody, Hip2 antibody, Hypg antibody, Lig antibody, e2-25k antibody, hip2 antibody, hypg antibody, lig antibody, AW492011 antibody, D5Ertd601e antibody, ube2k antibody, zgc:103472 antibody, zgc:110791 antibody, ubiquitin conjugating enzyme E2 K antibody, ubiquitin-conjugating enzyme E2K antibody, ubiquitin conjugating enzyme E2 K S homeolog antibody, ubiquitin-conjugating enzyme E2Kb (UBC1 homolog, yeast) antibody, ubiquitin-conjugating enzyme E2Ka (UBC1 homolog, yeast) antibody, UBE2K antibody, Ube2k antibody, ube2k.S antibody, ube2k antibody, ube2kb antibody, ube2ka antibody

Background: HIP2 belongs to the ubiquitin-conjugating enzyme family. It binds selectively to a large region at the N terminus of huntingtin. This interaction is not influenced by the length of the huntingtin polyglutamine tract. This protein has been implicated in the degradation of huntingtin and suppression of apoptosis.

Molecular Weight: 22 kDa (MW of target protein)