UBE2N antibody

Catalog No. ABIN629720

Product Details anti-UBE2N Antibody

Target: UBE2N (Ubiquitin-Conjugating Enzyme E2N (UBE2N))

Reactivity: Human, Rat, Mouse, Zebrafish (Danio rerio), Dog, Drosophila melanogaster

Host: Rabbit

Clonality: Polyclonal

Conjugate: This UBE2N antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Purified

Immunogen: UBE2 N antibody was raised using a synthetic peptide corresponding to a region with amino acids GRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLANDVAEQWKTNE

Application Details

Application Notes: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

UBE2N Blocking Peptide, catalog no. 33R-3532, is also available for use as a blocking control in assays to test for specificity of this UBE2N antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UBE0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for UBE2N

Target: UBE2N (Ubiquitin-Conjugating Enzyme E2N (UBE2N))

Alternative Name: UBE2N (UBE2N Products)

Synonyms: UBC13 antibody, UbcH-ben antibody, UbcH13 antibody, 1500026J17Rik antibody, AL022654 antibody, BB101821 antibody, ube2n antibody, wu:fb11b03 antibody, wu:fc08b06 antibody, zgc:55726 antibody, ubc13 antibody, ubch-ben antibody, UBE2N antibody, ube2nl antibody, zgc:63901 antibody, ubiquitin conjugating enzyme E2 N antibody, ubiquitin-conjugating enzyme E2N antibody, ubiquitin conjugating enzyme E2 N S homeolog antibody, ubiquitin-conjugating enzyme E2Na antibody, ubiquitin-conjugating enzyme E2Nb antibody, UBE2N antibody, Ube2n antibody, ube2n.S antibody, ube2na antibody, LOC100533434 antibody, ube2n antibody, ube2nb antibody

Background: UBE2N encodes a member of the E2 ubiquitin-conjugating enzyme family. The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. Studies in mouse suggest that this protein plays a role in DNA postreplication repair.

Molecular Weight: 17 kDa (MW of target protein)

Pathways: TCR Signaling, Fc-epsilon Receptor Signaling Pathway, Activation of Innate immune Response, Toll-Like Receptors Cascades, Positive Regulation of Response to DNA Damage Stimulus, Ubiquitin Proteasome Pathway