MAT1A antibody (C-Term)
-
- Target See all MAT1A Antibodies
- MAT1A (Methionine Adenosyltransferase I, alpha (MAT1A))
-
Binding Specificity
- C-Term
-
Reactivity
- Human, Dog
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This MAT1A antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- MAT1 A antibody was raised against the C terminal of MAT1
- Purification
- Purified
- Immunogen
- MAT1 A antibody was raised using the C terminal of MAT1 corresponding to a region with amino acids VAKSLVKAGLCRRVLVQVSYAIGVAEPLSISIFTYGTSQKTERELLDVVH
- Top Product
- Discover our top product MAT1A Primary Antibody
-
-
- Application Notes
-
WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
MAT1A Blocking Peptide, catalog no. 33R-9422, is also available for use as a blocking control in assays to test for specificity of this MAT1A antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MAT0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MAT1A (Methionine Adenosyltransferase I, alpha (MAT1A))
- Alternative Name
- MAT1A (MAT1A Products)
- Background
- MAT1A catalyzes a two-step reaction that involves the transfer of the adenosyl moiety of ATP to methionine to form S-adenosylmethionine and tripolyphosphate, which is subsequently cleaved to PPi and Pi. S-adenosylmethionine is the source of methyl groups for most biological methylations. MAT1A is found as a homotetramer (MAT I) or a homodimer (MAT III) whereas a third form, MAT II (gamma), is encoded by the MAT2A gene. Mutations in its gene are associated with methionine adenosyltransferase deficiency.
- Molecular Weight
- 44 kDa (MW of target protein)
- Pathways
- Mitotic G1-G1/S Phases, M Phase, Ribonucleoside Biosynthetic Process, Methionine Biosynthetic Process
-