Asialoglycoprotein Receptor 2 antibody (N-Term)

Catalog No. ABIN629718

Product Details anti-Asialoglycoprotein Receptor 2 Antibody

Target: Asialoglycoprotein Receptor 2 (ASGR2)

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Asialoglycoprotein Receptor 2 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: ASGR2 antibody was raised against the N terminal of ASGR2

Purification: Purified

Immunogen: ASGR2 antibody was raised using the N terminal of ASGR2 corresponding to a region with amino acids STLTEVQAISTHGGSVGDKITSLGAKLEKQQQDLKADHDALLFHLKHFPV

Application Details

Application Notes: WB: 4 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ASGR2 Blocking Peptide, catalog no. 33R-8876, is also available for use as a blocking control in assays to test for specificity of this ASGR2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ASGR2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Asialoglycoprotein Receptor 2

Target: Asialoglycoprotein Receptor 2 (ASGR2)

Alternative Name: ASGR2 (ASGR2 Products)

Synonyms: ASGR2 antibody, asgr2 antibody, MGC137129 antibody, ASGP-R2 antibody, ASGPR2 antibody, CLEC4H2 antibody, HBXBP antibody, HL-2 antibody, Asgr antibody, Asgr-2 antibody, asialoglycoprotein receptor 2 antibody, C-type lectin domain family 10 member A antibody, ASGR2 antibody, clec10a antibody, Asgr2 antibody, LOC100347178 antibody

Background: ASGR2 is a cell surface receptor that binds to galactose-terminated glycoproteins. It transports these glycoproteins via a series of membrane vesicles and tubules to an acidic-sorting organelle where the receptor and ligand dissociates. Then the receptor is recycled back to the cell surface. There are four alternatively spliced transcript variants of this gene. This gene has multiple polyadenylation sites.

Molecular Weight: 34 kDa (MW of target protein)

Pathways: Thyroid Hormone Synthesis