LIM Domain Binding 3 Protein antibody (N-Term)

Catalog No. ABIN629714

Product Details anti-LIM Domain Binding 3 Protein Antibody

Target: LIM Domain Binding 3 Protein (LDB3) (LIM Domain Binding 3 (LDB3))

Binding Specificity: N-Term

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This LIM Domain Binding 3 Protein antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: LDB3 antibody was raised against the N terminal of LDB3

Purification: Purified

Immunogen: LDB3 antibody was raised using the N terminal of LDB3 corresponding to a region with amino acids PVIPHQKDPALDTNGSLVAPSPSPEARASPGTPGTPELRPTFSPAFSRPS

Application Details

Application Notes: WB: 0.625 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

LDB3 Blocking Peptide, catalog no. 33R-7412, is also available for use as a blocking control in assays to test for specificity of this LDB3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LDB3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for LIM Domain Binding 3 Protein

Target: LIM Domain Binding 3 Protein (LDB3) (LIM Domain Binding 3 (LDB3))

Alternative Name: LDB3 (LDB3 Products)

Synonyms: CMD1C antibody, CYPHER antibody, LDB3Z1 antibody, LDB3Z4 antibody, LVNC3 antibody, MFM4 antibody, ORACLE antibody, PDLIM6 antibody, ZASP antibody, AW742271 antibody, ldb3l antibody, zgc:55814 antibody, wu:fi31d08 antibody, ldb3 antibody, MGC52706 antibody, MGC75668 antibody, RGD1564875 antibody, LDB3 antibody, cypher antibody, hm:zehn1639 antibody, zehn1639 antibody, LIM domain binding 3 antibody, LIM domain binding 3b antibody, LIM domain binding 3 S homeolog antibody, LIM domain binding 3a antibody, LDB3 antibody, Ldb3 antibody, ldb3b antibody, ldb3.S antibody, ldb3 antibody, ldb3a antibody

Background: LDB3 may function as an adapter in striated muscle to couple protein kinase C-mediated signaling via its LIM domains to the cytoskeleton.

Molecular Weight: 36 kDa (MW of target protein)