HMGCS2 antibody

Catalog No. ABIN629710

Product Details anti-HMGCS2 Antibody

Target: HMGCS2 (3-Hydroxy-3-Methylglutaryl-CoA Synthase 2 (Mitochondrial) (HMGCS2))

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This HMGCS2 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Purified

Immunogen: HMGCS2 antibody was raised using a synthetic peptide corresponding to a region with amino acids PKDVGILALEVYFPAQYVDQTDLEKYNNVEAGKYTVGLGQTRMGFCSVQE

Application Details

Application Notes: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

HMGCS2 Blocking Peptide, catalog no. 33R-7166, is also available for use as a blocking control in assays to test for specificity of this HMGCS2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HMGCS2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for HMGCS2

Target: HMGCS2 (3-Hydroxy-3-Methylglutaryl-CoA Synthase 2 (Mitochondrial) (HMGCS2))

Alternative Name: HMGCS2 (HMGCS2 Products)

Synonyms: 1300002P16 antibody, mHS antibody, DDBDRAFT_0219349 antibody, DDBDRAFT_0219924 antibody, DDB_0219349 antibody, DDB_0219924 antibody, Hmgcs1 antibody, Mt3h3mg antibody, hmgCoA antibody, 3-hydroxy-3-methylglutaryl-CoA synthase 2 antibody, 3-hydroxy-3-methylglutaryl-Coenzyme A synthase 2 antibody, hydroxymethylglutaryl-CoA synthase antibody, hydroxymethylglutaryl-coa synthase antibody, 3-HYDROXY-3-METHYLGLUTARYL-CoA SYNTHASE 2 antibody, HMGCS2 antibody, Hmgcs2 antibody, mvaS antibody, CNC05080 antibody, HMCS1 antibody, hgsA antibody, MFER_RS00425 antibody, LOC100285783 antibody, ECU10_0510 antibody, Eint_100450 antibody

Background: HMGCS2 condenses acetyl-CoA with acetoacetyl-CoA to form HMG-CoA, which is the substrate for HMG-CoA reductase.

Molecular Weight: 56 kDa (MW of target protein)

Pathways: Response to Growth Hormone Stimulus, Cellular Response to Molecule of Bacterial Origin, Regulation of Lipid Metabolism by PPARalpha