WDR13 antibody (N-Term)

Catalog No. ABIN629704

Product Details anti-WDR13 Antibody

Target: WDR13 (WD Repeat Domain 13 (WDR13))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This WDR13 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: WDR13 antibody was raised against the N terminal of WDR13

Purification: Purified

Immunogen: WDR13 antibody was raised using the N terminal of WDR13 corresponding to a region with amino acids GQRYGPLSEPGSARAYSNSIVRSSRTTLDRMEDFEDDPRALGARGHRRSV

Application Details

Application Notes: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

WDR13 Blocking Peptide, catalog no. 33R-3511, is also available for use as a blocking control in assays to test for specificity of this WDR13 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of WDR13 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for WDR13

Target: WDR13 (WD Repeat Domain 13 (WDR13))

Alternative Name: WDR13 (WDR13 Products)

Synonyms: MGC80988 antibody, MGC79608 antibody, WDR13 antibody, DKFZp469E2032 antibody, MG21 antibody, 1700060B08Rik antibody, 5730411P10Rik antibody, DXHXS7467e antibody, W51679 antibody, mMg21 antibody, RGD1560982 antibody, WD repeat domain 13 L homeolog antibody, WD repeat domain 13 antibody, wdr13.L antibody, wdr13 antibody, WDR13 antibody, Wdr13 antibody

Background: WDR13 is a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. WDR13 gene is widely expressed in various tissues, and located in chromosome X. The function of this gene has not been determined.

Molecular Weight: 53 kDa (MW of target protein)