WDR13 antibody (N-Term)
-
- Target See all WDR13 Antibodies
- WDR13 (WD Repeat Domain 13 (WDR13))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse, Rat, Dog
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This WDR13 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- WDR13 antibody was raised against the N terminal of WDR13
- Purification
- Purified
- Immunogen
- WDR13 antibody was raised using the N terminal of WDR13 corresponding to a region with amino acids GQRYGPLSEPGSARAYSNSIVRSSRTTLDRMEDFEDDPRALGARGHRRSV
- Top Product
- Discover our top product WDR13 Primary Antibody
-
-
- Application Notes
-
WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
WDR13 Blocking Peptide, catalog no. 33R-3511, is also available for use as a blocking control in assays to test for specificity of this WDR13 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of WDR13 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- WDR13 (WD Repeat Domain 13 (WDR13))
- Alternative Name
- WDR13 (WDR13 Products)
- Background
- WDR13 is a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. WDR13 gene is widely expressed in various tissues, and located in chromosome X. The function of this gene has not been determined.
- Molecular Weight
- 53 kDa (MW of target protein)
-