FECH antibody

Catalog No. ABIN629703

Product Details anti-FECH Antibody

Target: FECH (Ferrochelatase (FECH))

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FECH antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Purified

Immunogen: FECH antibody was raised using a synthetic peptide corresponding to a region with amino acids LDRDLMTLPIQNKLAPFIAKRRTPKIQEQYRRIGGGSPIKIWTSKQGEGM

Application Details

Application Notes: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

FECH Blocking Peptide, catalog no. 33R-4860, is also available for use as a blocking control in assays to test for specificity of this FECH antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FECH antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for FECH

Target: FECH (Ferrochelatase (FECH))

Alternative Name: FECH (FECH Products)

Synonyms: AI894116 antibody, Fcl antibody, fch antibody, zgc:109851 antibody, EPP antibody, FCE antibody, CG2098 antibody, Dmel\\CG2098 antibody, GB15952 antibody, ferrochelatase L homeolog antibody, ferrochelatase antibody, Ferrochelatase antibody, ferrochelatase, mitochondrial antibody, ferrochelatase HemH antibody, ferrochelatase (predicted) antibody, fech.L antibody, hemH antibody, Fech antibody, FECH antibody, fech antibody, FeCH antibody, LOC409922 antibody, hem15 antibody, APH_RS01140 antibody

Background: Ferrochelatase is localized to the mitochondrion where it catalyzes the insertion of the ferrous form of iron into protoporphyrin IX in the heme synthesis pathway. Defects in ferrochelatase are associated with protoporphyria.Ferrochelatase is localized to the mitochondrion where it catalyzes the insertion of the ferrous form of iron into protoporphyrin IX in the heme synthesis pathway. Defects in ferrochelatase are associated with protoporphyria. Two transcript variants encoding different isoforms have been found for this gene.

Molecular Weight: 47 kDa (MW of target protein)

Pathways: Transition Metal Ion Homeostasis