RGS20 antibody (N-Term)

Catalog No. ABIN629702

Product Details anti-RGS20 Antibody

Target: RGS20 (Regulator of G-Protein Signaling 20 (RGS20))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RGS20 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: RGS20 antibody was raised against the N terminal of RGS20

Purification: Purified

Immunogen: RGS20 antibody was raised using the N terminal of RGS20 corresponding to a region with amino acids KHFSRPSIWTQFLPLFRAQRYNTDIHQITENEGDLRAVPDIKSFPPAQLP

Application Details

Application Notes: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RGS20 Blocking Peptide, catalog no. 33R-4413, is also available for use as a blocking control in assays to test for specificity of this RGS20 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RGS20 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RGS20

Target: RGS20 (Regulator of G-Protein Signaling 20 (RGS20))

Alternative Name: RGS20 (RGS20 Products)

Synonyms: RGSZ1 antibody, ZGAP1 antibody, zgc:92650 antibody, rgsz1 antibody, zgap1 antibody, GzGAP antibody, RSG20 antibody, 2900073E09Rik antibody, Rgsz1 antibody, regulator of G protein signaling 20 antibody, regulator of G-protein signaling 20 L homeolog antibody, regulator of G-protein signaling 20 antibody, RGS20 antibody, rgs20 antibody, rgs20.L antibody, Rgs20 antibody

Background: Regulator of G protein signaling (RGS) proteins are regulatory and structural components of G protein-coupled receptor complexes. RGS proteins are GTPase-activating proteins for Gi and Gq class G-alpha proteins. They accelerate transit through the cycle of GTP binding and hydrolysis and thereby accelerate signaling kinetics and termination.

Molecular Weight: 44 kDa (MW of target protein)

Pathways: Myometrial Relaxation and Contraction, Regulation of G-Protein Coupled Receptor Protein Signaling