CDR2 antibody (N-Term)

Catalog No. ABIN629700

Product Details anti-CDR2 Antibody

Target: CDR2 (Cerebellar Degeneration-Related Protein 2, 62kDa (CDR2))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CDR2 antibody is un-conjugated

Application: Immunohistochemistry (IHC), Western Blotting (WB)

Specificity: CDR2 antibody was raised against the N terminal of CDR2

Purification: Purified

Immunogen: CDR2 antibody was raised using the N terminal of CDR2 corresponding to a region with amino acids MLAENLVEEFEMKEDEPWYDHQDLQQDLQLAAELGKTLLDRNTELEDSVQ

Application Details

Application Notes: WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CDR2 Blocking Peptide, catalog no. 33R-6176, is also available for use as a blocking control in assays to test for specificity of this CDR2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CDR2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CDR2

Target: CDR2 (Cerebellar Degeneration-Related Protein 2, 62kDa (CDR2))

Alternative Name: CDR2 (CDR2 Products)

Synonyms: CDR62 antibody, Yo antibody, cdr2 antibody, MGC69206 antibody, CDR2 antibody, AA617262 antibody, RGD1310578 antibody, cerebellar degeneration related protein 2 antibody, cerebellar degeneration related protein 2 L homeolog antibody, cerebellar degeneration-related 2 antibody, cerebellar degeneration-related protein 2 antibody, cerebellar degeneration related protein 2 like antibody, CDR2 antibody, cdr2 antibody, cdr2.L antibody, Cdr2 antibody, CDR2L antibody, LOC101060399 antibody

Background: Cdr2 normally sequesters c-Myc in the neuronal cytoplasm, thereby down-regulating c-Myc activity, and suggest a mechanism whereby inhibition of cdr2 function by autoantibodies in PCD may contribute to Purkinje neuronal.

Molecular Weight: 52 kDa (MW of target protein)