CDR2 antibody (N-Term)
-
- Target See all CDR2 Antibodies
- CDR2 (Cerebellar Degeneration-Related Protein 2, 62kDa (CDR2))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse, Rat, Dog
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This CDR2 antibody is un-conjugated
-
Application
- Immunohistochemistry (IHC), Western Blotting (WB)
- Specificity
- CDR2 antibody was raised against the N terminal of CDR2
- Purification
- Purified
- Immunogen
- CDR2 antibody was raised using the N terminal of CDR2 corresponding to a region with amino acids MLAENLVEEFEMKEDEPWYDHQDLQQDLQLAAELGKTLLDRNTELEDSVQ
- Top Product
- Discover our top product CDR2 Primary Antibody
-
-
- Application Notes
-
WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
CDR2 Blocking Peptide, catalog no. 33R-6176, is also available for use as a blocking control in assays to test for specificity of this CDR2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CDR2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CDR2 (Cerebellar Degeneration-Related Protein 2, 62kDa (CDR2))
- Alternative Name
- CDR2 (CDR2 Products)
- Background
- Cdr2 normally sequesters c-Myc in the neuronal cytoplasm, thereby down-regulating c-Myc activity, and suggest a mechanism whereby inhibition of cdr2 function by autoantibodies in PCD may contribute to Purkinje neuronal.
- Molecular Weight
- 52 kDa (MW of target protein)
-