PNPLA5 antibody (N-Term)
-
- Target See all PNPLA5 Antibodies
- PNPLA5 (Patatin-Like phospholipase Domain Containing 5 (PNPLA5))
-
Binding Specificity
- N-Term
- Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PNPLA5 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- PNPLA5 antibody was raised against the N terminal of PNPLA5
- Purification
- Purified
- Immunogen
- PNPLA5 antibody was raised using the N terminal of PNPLA5 corresponding to a region with amino acids LSLSILHPAYAPIEHVKQQLQDALPPDAHVLASQRLGISLTRWPDGRNFL
- Top Product
- Discover our top product PNPLA5 Primary Antibody
-
-
- Application Notes
-
WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
PNPLA5 Blocking Peptide, catalog no. 33R-5438, is also available for use as a blocking control in assays to test for specificity of this PNPLA5 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PNPLA5 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PNPLA5 (Patatin-Like phospholipase Domain Containing 5 (PNPLA5))
- Alternative Name
- PNPLA5 (PNPLA5 Products)
- Background
- Human patatin-like phospholipases, such as PNPLA5, have been implicated in regulation of adipocyte differentiation and have been induced by metabolic stimuli.Human patatin-like phospholipases, such as PNPLA5, have been implicated in regulation of adipocyte differentiation and have been induced by metabolic stimuli.
- Molecular Weight
- 48 kDa (MW of target protein)
-