UXT antibody (N-Term)

Catalog No. ABIN629698

Product Details anti-UXT Antibody

Target: UXT (Ubiquitously-Expressed, Prefoldin-Like Chaperone (UXT))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This UXT antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: UXT antibody was raised against the N terminal of UXT

Purification: Purified

Immunogen: UXT antibody was raised using the N terminal of UXT corresponding to a region with amino acids MATPPKRRAVEATGEKVLRYETFISDVLQRDLRKVLDHRDKVYEQLAKYL

Application Details

Application Notes: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

UXT Blocking Peptide, catalog no. 33R-5785, is also available for use as a blocking control in assays to test for specificity of this UXT antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UXT antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for UXT

Target: UXT (Ubiquitously-Expressed, Prefoldin-Like Chaperone (UXT))

Alternative Name: UXT (UXT Products)

Synonyms: zgc:101894 antibody, 0910002B17Rik antibody, ART-27 antibody, STAP1 antibody, ubiquitously-expressed, prefoldin-like chaperone antibody, ubiquitously expressed prefoldin like chaperone antibody, ubiquitously-expressed transcript antibody, ubiquitously expressed transcript antibody, uxt antibody, UXT antibody, Uxt antibody

Background: UXT is a novel protein which is highly conserved in mouse. It interacts with the N-terminus of the androgen receptor and plays a role in facilitating receptor-induced transcriptional activation. It is also likely to be involved in tumorigenesis as it is abundantly expressed in tumor tissues.

Molecular Weight: 18 kDa (MW of target protein)

Pathways: Unfolded Protein Response