PCK1 antibody (Soluble)

Catalog No. ABIN629697

Product Details anti-PCK1 Antibody

Target: PCK1 (phosphoenolpyruvate Carboxykinase 1 (Soluble) (PCK1))

Binding Specificity: Soluble

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PCK1 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Purification: Purified

Immunogen: PCK1 antibody was raised using a synthetic peptide corresponding to a region with amino acids NGFFGVAPGTSVKTNPNAIKTIQKNTIFTNVAETSDGGVYWEGIDEPLAS

Application Details

Application Notes: WB: 0.2-1 µg/mL, IHC: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PCK1 Blocking Peptide, catalog no. 33R-6700, is also available for use as a blocking control in assays to test for specificity of this PCK1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PCK1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PCK1

Target: PCK1 (phosphoenolpyruvate Carboxykinase 1 (Soluble) (PCK1))

Alternative Name: PCK1 (PCK1 Products)

Synonyms: PEPCK-C antibody, PEPCK1 antibody, PEPCKC antibody, PEPCK antibody, PEPCK-M antibody, PEPCK2 antibody, 1810010O14Rik antibody, 9130022B02Rik antibody, cb856 antibody, cb924 antibody, fj93h11 antibody, zgc:63869 antibody, wu:fc51c05 antibody, wu:fj93h11 antibody, pepck-c antibody, pepck1 antibody, pepckc antibody, PCK1 antibody, PPCK1 antibody, AI265463 antibody, Pck-1 antibody, GTP antibody, PCK antibody, Pepck antibody, RATPEPCK antibody, Ppc1C antibody, PHOSPHOENOLPYRUVATE CARBOXYKINASE antibody, T28I19.150 antibody, T28I19_150 antibody, phosphoenolpyruvate carboxykinase 1 antibody, 143299_at antibody, CG10924 antibody, CG17725 antibody, Dmel\\CG17725 antibody, Dromel_CG17725_FBtr0086701_pepck_mORF antibody, dPEPCK antibody, pepck antibody, PEPC antibody, PEPCase antibody, ppc antibody, phosphoenolpyruvate carboxykinase 1 antibody, phosphoenolpyruvate carboxykinase 2, mitochondrial antibody, phosphoenolpyruvate carboxykinase 2 (mitochondrial) antibody, phosphoenolpyruvate carboxykinase 1 (soluble) antibody, phosphoenolpyruvate carboxykinase 1 S homeolog antibody, phosphoenolpyruvate carboxykinase, cytosolic [GTP] antibody, phosphoenolpyruvate carboxykinase 1, cytosolic antibody, phosphoenolpyruvate carboxylase 7 antibody, Phosphoenolpyruvate carboxykinase antibody, phosphoenolpyruvate carboxylase antibody, PCK1 antibody, PCK2 antibody, Pck2 antibody, pck1 antibody, pck1.S antibody, LOC100634531 antibody, Pck1 antibody, pep7 antibody, Pepck antibody, LOC107777405 antibody

Background: PCK1 is a main control point for the regulation of gluconeogenesis. The cytosolic enzyme encoded by this gene, along with GTP, catalyzes the formation of phosphoenolpyruvate from oxaloacetate, with the release of carbon dioxide and GDP. The expression of PCK1 can be regulated by insulin, glucocorticoids, glucagon, cAMP, and diet.

Molecular Weight: 69 kDa (MW of target protein)

Pathways: Positive Regulation of Peptide Hormone Secretion, Carbohydrate Homeostasis