CA8 antibody (N-Term)

Catalog No. ABIN629695

Product Details anti-CA8 Antibody

Target: CA8 (Carbonic Anhydrase VIII (CA8))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat, Dog, Zebrafish (Danio rerio)

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CA8 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: Carbonic Anhydrase VIII antibody was raised against the N terminal of CA8

Purification: Purified

Immunogen: Carbonic Anhydrase VIII antibody was raised using the N terminal of CA8 corresponding to a region with amino acids YEEGVEWGLVFPDANGEYQSPINLNSREARYDPSLLDVRLSPNYVVCRDC

Application Details

Application Notes: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Carbonic Anhydrase VIII Blocking Peptide, catalog no. 33R-10083, is also available for use as a blocking control in assays to test for specificity of this Carbonic Anhydrase VIII antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CA8 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CA8

Target: CA8 (Carbonic Anhydrase VIII (CA8))

Alternative Name: Carbonic Anhydrase VIII (CA8 Products)

Synonyms: AW546993 antibody, Ca8 antibody, Cals antibody, Cals1 antibody, Carp antibody, wdl antibody, zgc:110118 antibody, CA-VIII antibody, CALS antibody, CAMRQ3 antibody, CARP antibody, carbonic anhydrase 8 antibody, carbonic anhydrase VIII antibody, CAH8 antibody, Car8 antibody, ca8 antibody, CA8 antibody

Background: CA8 was initially named CA-related protein because of sequence similarity to other known carbonic anhydrase genes. However, CA8 lacks carbonic anhydrase activity (i.e., the reversible hydration of carbon dioxide). CA8 continues to carry a carbonic anhydrase designation based on clear sequence identity to other members of the carbonic anhydrase gene family.

Molecular Weight: 32 kDa (MW of target protein)