PPIF antibody

Catalog No. ABIN629692

Product Details anti-PPIF Antibody

Target: PPIF (Peptidylprolyl Isomerase F (PPIF))

Reactivity: Human, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PPIF antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Purified

Immunogen: PPIF antibody was raised using a synthetic peptide corresponding to a region with amino acids GSTFHRVIPSFMCQAGDFTNHNGTGGKSIYGSRFPDENFTLKHVGPGVLS

Application Details

Application Notes: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PPIF Blocking Peptide, catalog no. 33R-3589, is also available for use as a blocking control in assays to test for specificity of this PPIF antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PPIF antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PPIF

Target: PPIF (Peptidylprolyl Isomerase F (PPIF))

Alternative Name: PPIF (PPIF Products)

Synonyms: CYP3 antibody, CyP-M antibody, Cyp-D antibody, CypD antibody, CyP-D antibody, ppif antibody, wu:fd61c06 antibody, zgc:101753 antibody, AW457192 antibody, CyP-F antibody, PPIase antibody, Cyp-40 antibody, cypf antibody, peptidylprolyl isomerase F antibody, peptidylprolyl isomerase Fa antibody, peptidylprolyl isomerase F (cyclophilin F) antibody, peptidylprolyl isomerase D antibody, peptidylprolyl isomerase F L homeolog antibody, PPIF antibody, ppifa antibody, Ppif antibody, Ppid antibody, ppif antibody, ppif.L antibody

Background: PPIF is a member of the peptidyl-prolyl cis-trans isomerase (PPIase) family. PPIases catalyze the cis-trans isomerization of proline imidic peptide bonds in oligopeptides and accelerate the folding of proteins. This protein is part of the mitochondrial permeability transition pore in the inner mitochondrial membrane. Activation of this pore is thought to be involved in the induction of apoptotic and necrotic cell death.

Molecular Weight: 19 kDa (MW of target protein)

Pathways: Proton Transport, Negative Regulation of intrinsic apoptotic Signaling, Negative Regulation of Transporter Activity